PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_13759_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family bZIP
Protein Properties Length: 754aa    MW: 82123.5 Da    PI: 6.1818
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_13759_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1452.3e-14243305163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     e+elkr  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +   +L ++++    e a+l++++
  Neem_13759_f_1 243 EEELKRKARLMRNRESAQLSRQRKKHYVEELEDKVRAMHSTIADLNSKISFFMAENATLRQQL 305
                     799***********************************************9999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001702.8E-13243305IPR004827Basic-leucine zipper domain
SMARTSM003384.8E-17243307IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151245305IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-12246305No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-17247306No hitNo description
CDDcd147041.49E-21248299No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MADPLLTEAP PPPQHTNPSN DFDSLSIPPL DPLYLASQNN NPSSSSDDLD FVLDENCDFD  60
FNFDDFDNLY FPSENESFFL PSENPTDGQF GSFASDVEGV SCLPRDQEVK VSCTASPESG  120
SSGVSGNRAL LDVDSYLNYS SQNSGNQSSN SNSNSCDREF SGGPASSQGS ENCGSAVSSE  180
TTNAPSPDFD NLVVDQKIKV EEVSKMNIPK RKKEDEEMNN ESRSSKYLRS SLVNENVNDN  240
PSEEELKRKA RLMRNRESAQ LSRQRKKHYV EELEDKVRAM HSTIADLNSK ISFFMAENAT  300
LRQQLSGGSA MPPPGPHMGM YAAPHMAPMP YPWMPCPAPY MVKPQGSQVP LVPIPRLKPQ  360
QTAAPTKPKK SDSSKTKNDG SKNKNDGSKT KKVASVSFLG LLFFVLLFGG LVPFIDVKYG  420
VTDGVSGGYF GSSFYDQHRG RVLTVNGYSN WSHENNGNGF SNGRVDIGNR NKIFCERGIG  480
TTEKESQPSA RSDEFVRLGN ASEPLVASLY VPRNDKLVKI DGNLIIHSVL ASEKAMASQD  540
ASQANSNEET ALAIPDVRGN GARHSHLYRN PAERQRAITS GSADAVKDHM KSTAADGKLQ  600
QWFQEGLAGP LLSSGMCTEV FQFDVSPASA PGAIIPASSV ANITVEHRRN ATHVKKNRRI  660
LDRLPVPLNR ANLNITGEPV DRKSQKNSFQ GNKTASSMVV SVLVDPREAG DVDVDGMITP  720
KSLSRIFVVV LVDSVKYVTY SCVLPRSGVH LVTT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482041.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A067EF100.0A0A067EF10_CITSI; Uncharacterized protein
STRINGPOPTR_0016s03220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-169bZIP family protein